PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00058462001
Common NameGSBRNA2T00058462001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 343aa    MW: 37285.8 Da    PI: 7.836
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00058462001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.73e-3951111262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          k++a++cprC+s ntkfCyynnysl+qPr+fCk+CrryWt+GG+lrn+PvGgg+rknk+s+
  GSBRNA2T00058462001  51 KDQAINCPRCNSVNTKFCYYNNYSLTQPRFFCKGCRRYWTEGGSLRNIPVGGGSRKNKRSH 111
                          7899******************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2744103IPR003851Zinc finger, Dof-type
PfamPF027015.2E-3352109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.41655109IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105793IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPLEEIVT NTCPTQQASQ PQPPPSVGAA GVAERKTRPE KDQAINCPRC  60
NSVNTKFCYY NNYSLTQPRF FCKGCRRYWT EGGSLRNIPV GGGSRKNKRS HSSSISSSSD  120
ITTKKHHSDH HPHHHLMSIS QQGLTGQNPK TFETTQQDLN LGFPPHGLIR TNFTNLIHNT  180
GNNNTSTNNP FLGSSCSATS ALATSPLDLI RNNNCNNRNT SNSSFMGFPV HNQGPTSEGF  240
SMQDHYKPSN SNTTLLGFSL DHHHDNSEFH GGFQGGEGRE VGDDVNGRHL FPFEDLKLPV  300
SSSSSATINI DVNDHQKRAS GGDAAATSGG YWTGMLSGGS WC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00058462001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109305.10.0PREDICTED: dof zinc finger protein DOF4.6-like isoform X2
SwissprotQ8LAP81e-164DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A078HDE90.0A0A078HDE9_BRANA; BnaC03g62060D protein
STRINGBra010548.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34332761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-131Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]